0 % 40% of the time it's the Jan 29, 2013 · Wheels/Suspension: 5Zigen 19x8 Pro Racers-Falken F452 245/35/19 Tires-Eibach Sportline Springs Visual: S5 Grille-20% Tint-M3 Window lip Spoiler-LED Cluster/Switches-TWM Weighted Shift Knob Jul 17, 2011 · Just bought an 05 Altima last week and yesterday, after performing a full detail with a friend of mine I noticed an oil leak on the right/front side. Over the course of a week or so i get a light haze on the inside of the windshield. In this case, there is no point installing a new belt. As soon as the car starts to warm up it now smokes from under the hood behind engine near the firewall. The cracks run all along the seams but there are others that just cracked out of nowhere. Dec 20, 2004 · its probably not the valve cover gasket. The wrong size oil filter can also cause leaks out of the housing. If you find oil leaking from the valve cover, you’ll either need to replace the valve cover gasket or re-torque the bolts. Find the most common issues Why is my car low on oil? Your car is leaking oil or your car is burning oil. 5) Water leaking from top left driver side, above door. See full list on 700r4transmissionhq. Oil/Fluid Leak Inspection Service How much does a Oil/Fluid Leak Inspection cost? On average, the cost for a Nissan Altima Oil/Fluid Leak Inspection is $95 with $0 for parts and $95 for labor. 5s, 80,000 miles needs catalytic converter and engine. . Jun 29, 2011 · 2002-2006 Nissan Altima Discussion (2. to/2H4R0EoCDN: https://amzn. Mar 25, 2022 · Common 4th Gen Nissan Altima problems include oil leaks, starting problems, and poor fuel economy. 5, but I can't quite tell from your pics. Right above the half shaft. 2005 Nissan Frontier Super Black Crew Cab LE 4x4 W/Desert Leather interior. Jan 19, 2006 · It is hard to believe the lower chain cover is leaking More than likely it is the front main seal (which is behind the crank pulley) that is spewing oil making it look like the timing chain cover. This section will discuss the possible causes of such leaks and will focus on the following sub-sections: Damaged Steering Pump, Worn-Out Hoses, Seal Failure, and Loose Connections. On the other hand, my Altima hasn't used any oil, either. However there was a TSB out regarding the oil cooler seal leaking. A faulty upstream oxygen (O2) sensor can cause the check engine light to come on in Nissan Altima. Any suggestions? #. I went up to the Nissan dealer and ordered the new O ring for $3. Feb 11, 2009 · So I put the new one on, and now I notice the oil leak dripping, and it drips onto the floor very close to the alternator. Luckily I'm getting a 5 speed though. Average repair cost is $150 at 66,000 miles. its the gasket that goes under the valve cover, to seal the spark plug wells. 5 S - Precision Gray Mods: Altima SE-R gunmetal wheels · K&N Typhoon intake · Stillen cat-back exhaust · Bullydog GT Tuner · Racingline front strut tower brace · Racingline battery tie down · painted red taillights · Autokits rear diffuser · precision gray painted eyelids · GTR starter button · oem leather steering wheel · oem leather shift knob · foglights · oem Nov 9, 2009 · I have a 2005 Altima with the 2. Any suggestions? # 2008 2. half an hour should do it. Dec 31, 2007 · The plugs aren't fouling because of the oil leaks from the poor design of the valve cover spark plug tube oil seals. 5) Head gaskets don't always leak oil into coolant or coolant into oil. 5) General Nissan Altima Discussion (1993-2001) 2013-2018 Nissan Altima Discussion (2. 5L: Service type Oil is leaking into spark plug well Inspection: Estimate $114. Oct 31, 2019 · One of the most common automotive problems is an exhaust leak. Average failure mileage is 107,200 miles. The most common reasons a Nissan Altima has a vacuum leak are leaking vacuum hoses, leaking gaskets and seals, or bad actuators and valves. May 13, 2005 · 2005 Nissan Altima 3. Removing and installing the filter can interfere with the o-ring’s ability to seal properly. Did my research and found out this is a known accruing problem. Oct 9, 2008 · I have a 1998 Alti 5-speed. ” “My 2007 Nissan Altima dashboard suddenly started having cracks. replace the spark plug gasket, then new rtv to seal the valve cover. 5) •Restores lost refrigerant and oil •Contains Leak Sealer to help seal most common leaks in rubber hoses Aug 22, 2010 · 10 Altima 3. 5L: Service type Oil is leaking into spark plug well Inspection: Estimate $94. 5) I know it’s a common issue on the 2008 models, but i’m more irritated at the dash catching all my dogs fur on Oil leaks are a common problem in many vehicles, and the Nissan Altima is no exception. It’s t Feb 12, 2014 · SOURCE: Nissan Altima 2000 - Engine oil leaking problem. if you need one, go online for the best deal. 5L: Service type Oil is leaking Dec 20, 2014 · 2002-2006 Nissan Altima Discussion (2. Feb 7, 2013 · The OE gasket from the dealer is pretty cheap so I would recommend going with that one. I couldn't find a lot of info on this site, but I used Club Frontier for most of the info. ) then look at the engine and make sure the leak is not coming from above like possibly the valve cover gasket or from the oil sending unit. 5 s a couple of weeks ago. 5L engine. The 2007 Nissan Frontier has 1 problems reported for oil leaks. Nissan Altima: Burning Oil Symptoms. Maybe the ones that lose oil have leaks? Any drips on the Dec 20, 2012 · 2007-2012 Nissan Altima Discussion (2. Jan 7, 2020 · It’s essential to address leaks promptly to keep your Nissan Altima running efficiently and reliably. first i would clean the engine with purple power (degrease etc. Aug 11, 2023 · “My 2011 Nissan Altima has a melted dashboard and the clear coat is coming off. Skill level 2 out of 5. Oil leaks have to be fixed first. 2008 Nissan Altima engine problems with 131 complaints from Altima owners. Visible leak; Smoke from engine bay; Burning oil smells; Low oil; Valve Cover Gasket Replacement. The odometer is at 84,028 so definently still covered. The most common reasons a Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. Feb 28, 2024 · Oil tends to leak in Altimas with a 3. could also be oil filter is loose, or the old seal is still there and you have two of them. I guess other than that it's a pretty good engine. Is your's a 2. Otherwise, you need to identify where the oil leak is coming from and fix that part. Apr 20, 2011 · Infiniti used the DE up into 2006- and 2007 for those few Gs that had the stick shift. The vacuum leak will have a steady low reading like this, 4 days ago · You're probably familiar with the “Low Fuel” or “Check Oil” lights on your dashboard. You're probably familiar with the “Low Fuel” or “Check Oil” lights on your dashboard. its an easy fix. 1/6 Classification: Reference: Date: ST12-007a NTB12-078a Februar. Best thing to do is get a can of brake cleaner, spray all the oil off, crank the car up, and see where its coming from. Every once and a while i can smell the coolant but it is very hard to notice. Inspect Gaskets: Examine valve cover, oil pan, crankshaft, and camshaft gaskets for damage or wear. Recognizing the signs of a blown head gasket in your Jan 21, 2022 · 2008 Nissan Altima: Quick Overview. Sep 22, 2019 · Some common causes of oil leaks in Nissan Altima include worn-out drain plugs, damaged gaskets, and oil system component failure. Can't really see where it's coming from, but I was wondering if there's any typical spot prone to oil leaks. hotshot cai, obx cat-back, active tuning grounding kit, sprint springs on tokico struts, focuz racing strut tower bar, 2002 SpecV wheels, 215-45-17 Kumho Ecsta 711 tires, Exedy stage 1 clutch, DEPO clear headlights and turn signals, suspension tech rear sway bar Jun 28, 2011 · Or is it engine oil colored. I know that my intake manifold where the elbow spacer is, leaks a small amount of oil out the bottom since I dont have a catch can put on it right now. The oil cooler is the round plate that's about an inch thick that sits right behind the oil filter. Feb 14, 2008 · -Oil leaks. 2008 Nissan Altima May 20, 2013 · most common places for oil to leak would be valve cover gasket, oil pressure sending unit, and oil pan gasket. and that oil drips right onto the power steering pump. Im adding about 4 quarts of oil every 900 miles. Mar 23, 2006 · 94 Altima GXE 5 spd. 5 SE to get an oil change because my old ramps were too high. We have seen a new serpentine belt that lasted less than a week in an engine that leaks oil around the belt area. Nov 21, 2018 · Nissan Altima P0172 Causes. if they have to come to you, you can expect that $50-$75 estimate to jump to well over $120 at least. In your Nissan Altima, a power steering fluid leak can happen for various reasons. Engine coolant (which is also called antifreeze or anti-freeze) moves through the inside of your Altima engine and keeps it from overheating. You'd think Nissan would have addressed this somewhere along the line, but no. Any increase in engine RPM and vacuum means you have zeroed-in on the source of the leak. The most common causes of radiator leaks in a Nissan Altima are corrosion and grime buildup, lack of regular maintenance, pressure issues, and physical damage. make sure they disconnect your battery first to help protect the Apr 1, 2010 · The hardest part was sourcing the oil seal: Nissan OE 5527 posts · Joined 2008 My wife's 96 Altima just died again due the oil leak into distributor. Most importantly, there is a terrible glare from the damaged dashboard and it is a major safety hazard. any ideas and/or similar experiences?? 74k miles. Follow the steps in this video to see how to fix minor coolant (antifreeze) leaks in your 2010 Nissan Altima. to/2YYVXbjTOOLS:Neiko 1/2" Adjustable Torque Wrench, 50-250 ft-lbUS It is typically okay to drive a car with an oil leak as long as you add fluid regularly and do not let the fluid leak get too low. Jul 12, 2007 · On my brother's '99 Altima, he's developed a rather nasty oil leak on the passenger side of the engine, behind all the belts. Feb 1, 2021 · The oil filter must be screwed into the housing tightly to ensure the oil does not leak out of the filter as it flows through it. :angry2: I had to hunt down a low profile ramp and correct the oil level. Faulty O2 sensor. I am right at 122,000 miles and thinking about switching to the Mobil 1 High mileage synthetic oil 5W-30. Aug 27, 2011 · The small leak that seemed to have disappeared turned in to a flow of oil pretty much overnight. Is it OK to use the regular Mobil 1 synthetic oil on a 122,000 mile engine? May 21, 2023 · 2. The mechanic that fixed checked it 2 times within the last 2 months. you need the gasket for the spark plug wells, and a tube of rtv gasket maker. Jul 13, 2023 · One of Nissan Altima’s common transmission problems is a transmission leak. I think it is coming from the crank shaft area but my Haynes is calling it a timing chain housing oil seal. Other common leaks (not in that area) are rear main seal, oil pan gasket, then front main seal. after that, you have main crank and cam seals. Buy Nissan Oil Cooler Gasket (PN: 21304-JA11A)US: http://amzn. 99: Shop/Dealer Price $105. I have less than 400 miles on the vehicle. DO NOT over tighten the oil pan bolts, hoping it will stop the mysterious leak, like the original poster did. When I bought the car brand new i purchased the extend warranty Gold Plus 100,000 mile. The valve covers are composite material, you know, like some junk plastic toy. Leaking exhaust can be loud, smelly, and (depending on where the leak is coming from) dangerous. The most common reasons a 2018 Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. Tons and tons of recalls too. Damaged Steering Pump 2008 Nissan Altima Vacuum Leak - RepairPal Close Aug 16, 2023 · Identifying and fixing an oil leak on the passenger side of your Nissan Altima involves these steps: Locate the Leak: Trace the source of the leak by looking for oil drips, stains, or wet areas on the passenger side of the engine. Once I got home I put a cardboard under the car just to see if there is anymore leaks, and guess what the next morning there was a freakin' puddle of transmission fluid. as far as finding it, a shop can do that pretty easy and cheap for ya. pull the valve cover and clean all the old gasket material off it. Average failure mileage is 17,900 miles. It was oil litterally pouring out the front like a faucet. com/channel/UCQBzv-1KGnFxxlEsAOwuG0Q. Symptoms of an oil leak include oil leak coming from the Altima’s oil drain plug, a leaky oil filter gasket, a leak at the rear main seal, a loose oil fill plug or any other location that causes oil to leak under the car. Blue Smoke. 4 Altima had a oil leak. I don't wait until I've xxxx miles on the oil and filter. But new technologies bring with them new and often confusing warning lights. Oct 16, 2022 · I now seem to have the same problem after 6 months the coolant evaporates somewhere because there is no leak. The second time they changed the VTC solenoid. I have the same problem now. Whichever the case, it requires separating the engine from the transmission. There are no visible leaks or puddles, just seems to be burning through the oil super fast. 5S . it's an 02 3. There are a couple of different parts that could be causing these problems on your Nissan Altima. Aug 7, 2009 · Hate to bring up an old thread but my car is leaking oil in the same area as this thread. Oil Leak Symptoms. The worst complaints are blew head gasket, engine turns over, won't start, and knocking noise when the temperature is cold. NISSAN; POWER STEERING SYSTEM SERVICE INFORMATION . Bring old batteries back to life: https:// Mar 25, 2022 · Common 4th Gen Nissan Altima problems include oil leaks, starting problems, and poor fuel economy. Apr 2, 2009 · owning a fab shop, i can tell you a thing or two about welding on vehicles. As these engines age they can develop oil leaks from the valve cover gaskets (VCG). Nov 17, 2018 · Oil or coolant can damage the serpentine or timing belt fast. should be a quick (less than 1 hour) job. Dec 17, 2003 · 5. If your Nissan Altima has blown a head gasket, you may find it running poorly or not at all. The fron main seal is the MOST COMMON issue with GA16's and has been coverd on the forums thoroughly. Power reliability ratings are average, however, transmission failures are common, leading to an average lifespan of around 150,000 miles, shorter than some competitors. New features for the 2008 model year include a new coupe body style. Look under the car and saw it was leaking pretty badly. You should be able to see evidence that oil is leaking. 4L 16V common oil leak at the distributor shaft. 0 % 40% of the time it's the Nov 20, 2012 · At about 80,000 miles my 2002 Nissan Altima had an issue where the coolant started leaking into to combustion chamber, had to have the heads resurfaced, and cat converters replaced. There is a TSB or technical service bulletins that shows a common leak from the oil cooler. Aug 16, 2023 · Identifying and fixing an oil leak on the passenger side of your Nissan Altima involves these steps: Locate the Leak: Trace the source of the leak by looking for oil drips, stains, or wet areas on the passenger side of the engine. Here are the most common causes of P0172 in the Nissan Altima: Vacuum Leaks– With the Nissan Altima, a vacuum leak is one of the most common causes of the P0172 code. The most common reasons a 2008 Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. Now the car burns oil, has to be replaced at about 1000 miles (completely empty if I let it go to 1500 miles). You can often fix an oil leak yourself for cheap by adding an oil leak stopper directly to the Altima oil fill hole. The most common reasons a 2024 Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. 5 SE Winter Frost. 5) 2007-2012 Nissan Altima Discussion (2. After all, the valve cover gaskets are made from a rubber material. com I’ve gone 4 years on a seeping valve cover until the oil started getting into the spark plug wells. 01 - $112. 5) Parts For Sale - FS Worst 2008 Nissan Altima Problems #1: Dashboard Is Melting 2008 Altima Average Cost to Fix: $1,300 Average Mileage: 73,000 mi. Oct 14, 2021 · 2013-2018 Nissan Altima Discussion (2. Evap ortie m s nC l VaporLines* Check vapor lines and connections for leaks or looseness. Again no visual leak. It could be an engine oil leaking from the car, because the gaskets have experienced too much wear and tear. Oct 2, 2023 · 2007-2012 Nissan Altima Discussion (2. Feb 27, 2022 · 1. 5 SE-R Sheer Silver / Black/Red interior SOLD to CarMax to buy a brand new 2008 Honda EXL RES/NAV to help transport our new triplets SE-R will be missed greatly. Any info is much appreciated! Nov 17, 2020 · Easy fix for an oil leak in a Nissan Altima. Very common to leak. Sep 8, 2012 · My steering wheels started to make funny noise the other day and found the fluid to be low, therefore I refilled to the line that said "High" 2 Days later it's at the "low" line again. I have heard that sunroof leaking is a possibility, but in my Nov 17, 2020 · Easy fix for an oil leak in a Nissan Altima. 5 V6 VQ35DE engine. Now for the last of the common problems on the 3. , without being able to determine the root cause. It's not leaking from the top, but somewhere around the middle of the block. Jun 16, 2008 · I purchased a 2008 Altima 2. Sep 26, 2014 · SOURCE: I have oil leaking from on line, auto zone has a o ring for oil cooler at a reasonable cost. Jun 24, 2011 · I have a 1994 Nissan Sentra 5 speed 1. for it cools the oil for the engine. Just a thought The most common reasons a 2012 Nissan Altima has a vacuum leak are leaking vacuum hoses, leaking gaskets and seals, or bad actuators and valves. Here is the problem, my local Walmart does not carry 5W-30, only 10W-30. lol. It WILL cause the oil pan to leak, when it bends the oil pan under the excessive pressure. Learn More #2: Transmission Failure 2008 Altima Dec 6, 2013 · I just realized mine was leaking yesterday. a fan blows air on engine oil cooler for The most common reasons a 2008 Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. The car is not smoking, doesn't have any milky mixture in the engine oil. Oct 6, 2014 · There was oil everywhere. I In this video we will be repairing Nissan's KA24DE 2. I have been back to the dealer twice about the leak. I noticed an oil leak on the passenger side of the oil pan. valve cover gasket is new, and the block is really clean, except from the oil pan down, directly behind/around the crank pulley, on the side of the engine. i don Sep 16, 2010 · basically, i know its coming from behind the crank pulley. Causes of a Radiator Leak: Nissan Altima. After a couple of days found that the oil was over the crosshatched marker of the dipstick. Prices may vary d Apr 10, 2002 · Transmission Leak! F**k Me! So I had a minor transmission leak on the driver's side and had a mechanic replace some gasket. The most obvious and a telltale sign that your Altima is burning oil is blue smoke. Hope you find the prblem. If you notice oil leaking from your Nissan Altima, it’s time to remove the oil filter and oil cooler and replace the o-ring. 5 is an excellent engine. An engine oil leak can cause burning smell in Nissan Altima, particularly when oil drips onto the exhaust system. 49: 2008 Nissan Altima L4-2. had an oil consumption problem when I bought it . Leaking Exhaust Symptoms: Nissan Altima A leaking exhaust system affects your Altima If the engine is wet above the filter, the gasket for the front cover could be leaking, but that isn't very common. Oct 11, 2002 · I took my Altima 3. For recommend - ed oil grade and viscosity refer to Chapter 9 in your Owner’s Manual. Is this a good idea? Next question is, any ideas as to where the leak may be coming from? Jan 26, 2014 · I still noticed the level going down from like max to low in a few days. If your leaking coolant like I was just replace the rusted steel line with heater hose. A friend suggested I cover the alternator with something to keep more oil from getting into the new one until I can fix the leak. 2006 Nissan Altima L4-2. 5 or 3. A refrigerant leak will cause the AC to blow warm or hot air. I had the belts checked and they were all good, but then when they took off the shroud (usually taken off during the oil change process), they saw a lot of oil. It’s not an exhaustive list, but those are a few other common areas. 99 - $132. they checked and said it was ok, it is gulping quarts of oil. try to tighten the bolts on the valve cover and even the oil pan. too high or you have a slow leak or flat. Feb 17, 2008 · Great information regarding Oil Cooler Leaks 1999-2004 Pathfinder I've found a diagram for oil cooler parts. Could be snake oil but full synthetic is good to run anyways Nov 25, 2019 · It’s when you are putting in a quart every 1 or 2 thousand miles that you are really consuming oil. This typically develops at the crimp connection. ” The most common reasons a 2009 Nissan Altima is leaking oil are oil system component failure and leaking engine gaskets. Aug 15, 2020 · When a Nissan Altima leaks oil on the passenger's side, it could indicate a number of things. During an oil change, the oil filter is sometimes replaced. The next day, it is still leaking. 5SR Navy Blue, Sport Pkg, Aluminum Kick Plates 09 Altima 2. Jul 4, 2011 · Hello guys, i bought a 2009 altima coupe 2. Fix. It’s important to change your oil filter every 3,000 miles during an oil change, as this keeps the filter clean and allows technicians to ensure it Nov 26, 2019 · It’s almost always caused by oil leaking from the valve covers onto the exhaust manifold. I found the leak, it is coming from the oil cooler, but the metal gasket is in tact. if the cooler is contaminated or corroded it needs replaced. 5L V6 engine because the oil filter is attached to the cooler. Leak Detector 6. Jan 17, 2014 · Since I didn't see any leaks or smoke I was advised to try switching back to dino oil as well as replace PCV valve. But I don't drive a lot of miles, and I get the oil changed a couple times a year. I check the exhaust system and I found a small hole in bottom of flex pipe. I have seen this major oil leak with all Distributor st Feb 5, 2018 · This is a quick video of the oil cooler on a 2008 Nissan Altima. It is important to regularly check your oil level and look for any signs of leaks, such as oil spots on your driveway or smoke coming from your engine. The metal was so thin that it could not be welded and then I noticed the whole exhaust pipe was one piece (and included the catalytic converter). 5) Leaking oil or coolant?. It could also be that the oil cooler is not properly sealed, and is dripping oil. So I took it to the people that I haven going to get my oil change since I stopped going to Infiniti. This leak often occurs after an oil change because the oil filter is attached to the cooler and removing and installing the oil filter can alter the oil cooler o-ring sealing capabilities. D. Oct 25, 2022 · The leaking fluid is gonna be oil (leaking past the crank shaft seal) or transmission fluid (leaking past the torque converter seal). car is burning mad oil, no leaks . Just got it checked again yesterday and he told me that there where no leaks. 6, and I noticed an oil leak under the car which I thought was engine oil, until I smelled it, and it smells like gear oil. I put 18 lbs of pressure. Vertically, it's a few inches inward from the right headlight, the oil actually accumulates and drips down the right side of the frame. 5 a month ago with 12000 miles, it appears to possibly have a coolant leak in the heater core. I know the 3. Pricing for Common 2008 Nissan Altima Repairs The 2007 Nissan Altima has 1 problems reported for oil leak. Yesterday I looked under the car and noticed oil is leaking slowly in small droplets at the bottom of the transmission housing (1 drop per 5 minutes something like that) Jun 18, 2012 · My 2008 Altima began making loud noise when accelerating. It appears to be leaking from the drivers side axle where the axle meets up with the transmission. APPLIED VEHICLES: Aug 8, 2011 · 2007 Altima 2. Jan 28, 2017 · Fixed Leak Hello Everyone i fixed the Leak put the new Gasket and new Valve Cover no Oil anywhere the Pistons were FUll with half an inch of Gasoline inside so, I Sucked out the gas using BBQ sticks wrapped with Paper towel Took out all the Gas and Sprayed Break Cleaner inside the Pistons and repeated the process after 2 hours and removed a MAJOR part of the Gunk inside without having to Nissan Altima vehicles with the 3. For a valve cover to leak oil that fast, you should be smelling it and seeing smoke from under the hood. If your Nissan Altima has a leaking exhaust system, it should not be ignored. Feb 22, 2005 · Have a 2002 Nissan ALtima 2. Mar 28, 2011 · Many Nissan owners have reported excessive oil consumption for 2002, 2003, 2004 and 2005 models like Maxima, Altima, Pathfinders, etc. Read more Aug 29, 2003 · '00 Altima is pissing oil any common leaks? My girlfriends '00 altima just started pissing oil its a pretty steady leak because it leaves a very large deposit on the garage floor. Below you’ll find the symptoms, causes, and price of a Nissan Altima head gasket. Average failure mileage is 150,000 miles. Either of the following could be the cause of transmission fluid leaks; It is typically okay to drive a car with an oil leak as long as you add fluid regularly and do not let the fluid leak get too low. The story should rightly infuriate many owners who have spent so much money trying to fix the issue Jan 19, 2019 · How to fix the oil cooler leak on a 2008 to 2013 Nissan Rogue as well as 2007 to 2012 altima 2. Take a look around and see if you can find a vacuum leak. The combustion ring could be blown, and as the Mar 27, 2007 · Oil pressure sending switch, located on the bottom of the oil filter pedestal. let them know at auto zone, and they should be able to advise you. Jul 30, 2009 · One month ago oil light went on, checked oil and low. To learn if this is the problem with your vehicle, you’ll need to run a dye test. These leaks can be caused by worn gaskets, faulty seals, or a cracked oil pan. It turned out to be a leaking oil pan gasket $15 and a leaking oil filter sandwich gasket $5 Nissan Altima vehicles with the 3. https://youtube. For that, you'll find oil up close to the top of the engine. Word of caution. Jan 9, 2024 · Other oil leaks are also possible and do happen. What I want to know is if driving around with the oil overfilled for 3-4 days do any damage to my May 22, 2019 · One of the most common (and) critical major engine problems is a blown head gasket. The Nissan engine isn’t alone here as valve cover leaks are common on plenty of engines. I have noticed in the last few weeks oil spots in the drive way. Jan 3, 2009 · 2007-2012 Nissan Altima Discussion (2. I'm going to try to change the o-ring and washer for my leaking Pathfinder oil cooler. Vacuum Gauge Personally, I prefer using a vacuum gauge first to check for low vacuum and then follow up by spraying carb cleaner on joints or pinching the vacuum hose(s). Also, the torque wrench is a good idea if the bolt for the oil cooler is wrenched to tight it will crush the new gasket and you wont get a proper seal. Now I think I know the culprit. The vehicle also failed the emissions test. Nov 17, 2020 · Easy fix for an oil leak in a Nissan Altima. Went to Nissan for diagnostic check and they said the 2002 Nissan Altima 2. A better suspect would be a leaking valve cover gasket. 5) 2008 Altima 3. 5 4 cylinder engine. Edit: If the leak isn’t caused by a major crack or split, try running high mileage full synthetic oil in your car. Look for potential leaks from the main seals and IVTC solenoid. Jun 5, 2012 · 2002-2006 Nissan Altima Discussion (2. replace the front oil seal. Has additives that rejuvenate seals. Price to repair oil leaks will depend on the source of the leak. I put a coolant system pressure tester to see if I can pinpoint the leak. 5 SE. Sep 30, 2008 · He said with the number of miles (154,xxx), it could be a leak coming from the block. Here are the most common symptoms of burning oil: 1. The 2015 Nissan Altima has 2 problems reported for oil leak. Feb 5, 2018 · This is a quick video of the oil cooler on a 2008 Nissan Altima. most shops will charge around $50-$75 per hour depending on where exactly you live. Nov 30, 2019 · Causes of Power Steering Fluid Leak. 5S Brick Red, no options from the factory Added: Nissan Fogs, K&N Typhoon intake, and 2J Racing Crank Pulley so far 00 Altima SE Super Black Automagic (handed down to my 16yo son) Tokico Struts Racingline rear endlinks Jun 16, 2008 · I purchased a 2008 Altima 2. car dealerships are a big ripoff. EASY FIX!!!!. 86. It might be leaking from the front seal of the oil pan gasket and as the oil leaks it gets on the crank and belts and throws oil all around. Mechanic said the oil was not leaking, yet we were losing oil every 100 miles. It looks like oil is leaking from the valve cover gasket. Jan 26, 2021 · AC Refrigerant Leak. Any suggestions? # Apr 3, 2019 · Tl the contact owns a 2007 Nissan Altima. The most common reasons a Nissan Altima has a coolant leak are loose hose connections, a broken radiator, or a failed water pump. take it into one of them. Nov 17, 2020 · I have a 10' Altima 2. It is typically okay to drive a car with an oil leak as long as you add fluid regularly and do not let the fluid leak get too low. cause if it isnt at least a little reddish then it probably isnt power steering fluid. The oil leak is coming from the top of the oil cooler, it is mid way between two bolts on the square part of the oil cooler. Jan 12, 2024 · 3) Oil Leak Problems. 3 days ago · You're probably familiar with the “Low Fuel” or “Check Oil” lights on your dashboard. 5L V6 engine can experience oil leaks from the engine due to a leaking oil cooler o-ring. The most common cause of a Nissan Altima refrigerant leak is a leak in the low-pressure AC hose. I clean the engine one day and after 3 days it gets dirty again. I was wondering if any of you can offer some advice as to where should I start by checking where the leak is and if there's any common place where the Alty leaks. The leak is coming from the passenger rear side of the motor. But I know the altima has other problems too such as the HEAT giving out, premature tire wear and some have transmission problems. Tighten Jan 8, 2007 · Couple of days ago I dropped of my 02 Nissan Altima to the dealership to have it checked out. 52: 2007 Nissan Altima L4-2. 2008 Nissan Altima Oct 31, 2007 · Same issue, all those years later. I did both but it did not help. It is a spray Replace engine oil and oil filter at the specified intervals. 5being mechanic. The oil seal looks like the one in the Haynes manual. The surface temperature of exhaust pipe or manifold can cross 800 degrees Fahrenheit (426 °C) under normal driving behavior. 99: Shop/Dealer Price $124. Follow the steps in this video to see how to fix minor coolant (antifreeze) leaks in your 2008 Nissan Altima. Even though a little leak won’t cause immediate issues, if you don’t fix it, it will suffer serious damage. Another common place is the oil pan. Checking Advance's website they have an oil seal and a crank seal. Look under the hood with the engine cold and off. According to J. Oil leak. Valve cover gaskets are a simple and pretty The 2002 Nissan Altima has 2 problems reported for mysterious oil leak. 5? The oil cooler TSB was for the 3. EngineValveClearance* Inspect only if valve noise increases. The contact stated that the vehicle had two dry rotted tires and there was an oil leak. 5S with 130K miles. Save It must just be leaking to the outside because I have had several oil Sep 22, 2019 · Some common causes of oil leaks in Nissan Altima include worn-out drain plugs, damaged gaskets, and oil system component failure. The car is running fine and the a/c cools and the heater works. y 6, 2015. The oxygen sensor is an important component of the vehicle’s emissions control system, and it monitors the amount of oxygen in the exhaust gases. Adjust valve clearance if necessary. 5 & 3. I believe that, with the help of the right mechanic, I have discovered the cause and why it has been so elusive. When I drive for 6,8 hours straight that where it happens, it is a 2011 Altima Nissan. you never know, you may get lucky. When this happens, the oil cooler could be affected Oct 8, 2008 · I've never heard of any issues with the timing cover. Leak from engine oil cooler. I'm fairly confident I'm able to change these parts with a few tools. Leaking coolant / antifreeze is one of the more common types of leaking fluid from Altima engines. Just came back from the dealer for a hands on view of the valve covers. If you notice an oil leak, try the following troubleshooting tips: Problem with your 2008 Nissan Altima? Our list of 26 known complaints reported by owners can help you fix your 2008 Nissan Altima. yslrcfhckhhqpekdgqsiggnyfmlnptbwiidhpnvcdkxevmyhxccjiaqif